MASTL Blocking Peptide (33R-6740)

A synthetic peptide for use as a blocking control in assays to test for specificity of MASTL antibody, catalog no. 70R-10147

Synonyms MASTL control peptide, MASTL antibody Blocking Peptide, Anti-MASTL Blocking Peptide, microtubule associated serine/threonine kinase-like Blocking Peptide, FLJ14813 Blocking Peptide, RP11-85G18.2 Blocking Peptide, THC2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL
Molecular Weight 97 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a microtubule-associated serine/threonine kinase. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors