MASTL Blocking Peptide (33R-6740)
A synthetic peptide for use as a blocking control in assays to test for specificity of MASTL antibody, catalog no. 70R-10147
Overview
Overview
| Synonyms | MASTL control peptide, MASTL antibody Blocking Peptide, Anti-MASTL Blocking Peptide, microtubule associated serine/threonine kinase-like Blocking Peptide, FLJ14813 Blocking Peptide, RP11-85G18.2 Blocking Peptide, THC2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL |
|---|---|
| Molecular Weight | 97 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a microtubule-associated serine/threonine kinase. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product