MAT2B antibody (70R-3571)

Rabbit polyclonal MAT2B antibody raised against the N terminal of MAT2B

Synonyms Polyclonal MAT2B antibody, Anti-MAT2B antibody, MATB-2, MATB 2, Nbla02999 antibody, MGC12237 antibody, TGR antibody, MAT-II antibody, MATB 2 antibody, MAT2B, Methionine Adenosyltransferase Ii Beta antibody, MATIIbeta antibody, MATB-2 antibody
Specificity MAT2B antibody was raised against the N terminal of MAT2B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAT2B antibody was raised using the N terminal of MAT2B corresponding to a region with amino acids KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA
Assay Information MAT2B Blocking Peptide, catalog no. 33R-4332, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody


Western Blot analysis using MAT2B antibody (70R-3571)

MAT2B antibody (70R-3571) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAT2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAT2B antibody (70R-3571) | MAT2B antibody (70R-3571) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors