Matrilin 2 antibody (70R-2250)

Rabbit polyclonal Matrilin 2 antibody raised against the middle region of MATN2

Synonyms Polyclonal Matrilin 2 antibody, Anti-Matrilin 2 antibody, Matrilin -2 antibody, Matrilin 2, Matrilin 2 antibody, Matrilin 2, Matrilin -2, MATN2 antibody
Specificity Matrilin 2 antibody was raised against the middle region of MATN2
Cross Reactivity Human
Applications WB
Immunogen Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
Assay Information Matrilin 2 Blocking Peptide, catalog no. 33R-1598, is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody

Images

Western Blot analysis using Matrilin 2 antibody (70R-2250)

Matrilin 2 antibody (70R-2250) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MATN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Matrilin 2 antibody (70R-2250) | Matrilin 2 antibody (70R-2250) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors