Matrin 3 antibody (70R-1389)

Rabbit polyclonal Matrin 3 antibody raised against the N terminal of MATR3

Synonyms Polyclonal Matrin 3 antibody, Anti-Matrin 3 antibody, MGC9105 antibody, Matrin 3, MATR3 antibody, Matrin -3, Matrin 3 antibody, DKFZp686K23100 antibody, DKFZp686K0542 antibody, Matrin 3, KIAA0723 antibody, Matrin -3 antibody
Specificity Matrin 3 antibody was raised against the N terminal of MATR3
Cross Reactivity Human
Applications IHC, WB
Immunogen Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA
Assay Information Matrin 3 Blocking Peptide, catalog no. 33R-6456, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody


Western Blot analysis using Matrin 3 antibody (70R-1389)

Matrin 3 antibody (70R-1389) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MATR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Matrin 3 antibody (70R-1389) | Matrin 3 antibody (70R-1389) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using Matrin 3 antibody (70R-1389) | Matrin 3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors