MAX Blocking Peptide (33R-6408)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAX antibody, catalog no. 70R-8413
Overview
Overview
| Synonyms | MAX control peptide, MAX antibody Blocking Peptide, Anti-MAX Blocking Peptide, MYC associated factor X Blocking Peptide, MGC10775 Blocking Peptide, MGC11225 Blocking Peptide, MGC18164 Blocking Peptide, MGC34679 Blocking Peptide, MGC36767 Blocking Peptide, orf1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MAX is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product