MBD1 antibody (70R-2023)

Rabbit polyclonal MBD1 antibody raised against the middle region of MBD1

Synonyms Polyclonal MBD1 antibody, Anti-MBD1 antibody, MBD 1 antibody, CXXC3 antibody, RFT antibody, MBD 1, PCM1 antibody, MBD-1, Methyl-Cpg Binding Domain Protein 1 antibody, MBD-1 antibody, MBD1
Specificity MBD1 antibody was raised against the middle region of MBD1
Cross Reactivity Human
Applications WB
Immunogen MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ
Assay Information MBD1 Blocking Peptide, catalog no. 33R-1727, is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody


Western blot analysis using MBD1 antibody (70R-2023)

Recommended MBD1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using MBD1 antibody (70R-2023) | Recommended MBD1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors