MBOAT1 Blocking Peptide (33R-1017)

A synthetic peptide for use as a blocking control in assays to test for specificity of MBOAT1 antibody, catalog no. 70R-3065

Synonyms MBOAT1 control peptide, MBOAT1 antibody Blocking Peptide, Anti-MBOAT1 Blocking Peptide, Membrane Bound O-Acyltransferase Domain Containing 1 Blocking Peptide, MGC44669 Blocking Peptide, OACT1 Blocking Peptide, dJ434O11.1 Blocking Peptide, MBOAT1, MBOAT-1, MBOAT 1, MBOAT-1 Blocking Peptide, MBOAT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors