MBOAT1 Blocking Peptide (33R-1017)
A synthetic peptide for use as a blocking control in assays to test for specificity of MBOAT1 antibody, catalog no. 70R-3065
Overview
Overview
| Synonyms | MBOAT1 control peptide, MBOAT1 antibody Blocking Peptide, Anti-MBOAT1 Blocking Peptide, Membrane Bound O-Acyltransferase Domain Containing 1 Blocking Peptide, MGC44669 Blocking Peptide, OACT1 Blocking Peptide, dJ434O11.1 Blocking Peptide, MBOAT1, MBOAT-1, MBOAT 1, MBOAT-1 Blocking Peptide, MBOAT 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product