MCM7 antibody (70R-1609)

Rabbit polyclonal MCM7 antibody raised against the N terminal of MCM7

Synonyms Polyclonal MCM7 antibody, Anti-MCM7 antibody, MCM 7 antibody, MCM-7 antibody, MCM 7, MCM-7, MCM7, Minichromosome Maintenance Complex Component 7 antibody
Specificity MCM7 antibody was raised against the N terminal of MCM7
Cross Reactivity Human
Applications WB
Immunogen MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV
Assay Information MCM7 Blocking Peptide, catalog no. 33R-5687, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody


Western Blot analysis using MCM7 antibody (70R-1609)

MCM7 antibody (70R-1609) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MCM7 antibody (70R-1609) | MCM7 antibody (70R-1609) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors