MCM7 antibody (70R-1612)

Rabbit polyclonal MCM7 antibody raised against the middle region of MCM7

Synonyms Polyclonal MCM7 antibody, Anti-MCM7 antibody, MCM7, MCM 7, MCM-7, MCM-7 antibody, Minichromosome Maintenance Complex Component 7 antibody, MCM 7 antibody
Specificity MCM7 antibody was raised against the middle region of MCM7
Cross Reactivity Human
Applications IHC, WB
Immunogen MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
Assay Information MCM7 Blocking Peptide, catalog no. 33R-3843, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody


Immunohistochemical staining using MCM7 antibody (70R-1612)

MCM7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MCM7 antibody (70R-1612) | MCM7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using MCM7 antibody (70R-1612) | MCM7 antibody (70R-1612) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors