MCM8 antibody (70R-1607)

Rabbit polyclonal MCM8 antibody raised against the N terminal of MCM8

Synonyms Polyclonal MCM8 antibody, Anti-MCM8 antibody, Minichromosome Maintenance Complex Component 8 antibody, MCM 8 antibody, MCM 8, MCM8, MCM-8, MCM-8 antibody
Specificity MCM8 antibody was raised against the N terminal of MCM8
Cross Reactivity Human,Mouse
Applications WB
Immunogen MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
Assay Information MCM8 Blocking Peptide, catalog no. 33R-2569, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Western Blot analysis using MCM8 antibody (70R-1607)

MCM8 antibody (70R-1607) used at 0.125 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using MCM8 antibody (70R-1607) | MCM8 antibody (70R-1607) used at 0.125 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors