Med10 Blocking Peptide (33R-10322)

A synthetic peptide for use as a blocking control in assays to test for specificity of Med10 antibody, catalog no. 70R-8974

Synonyms Med10 control peptide, Med10 antibody Blocking Peptide, Anti-Med10 Blocking Peptide, mediator of RNA polymerase II transcription, subunit 10 homolog, NUT2, S. cerevisiae Blocking Peptide, AA959813 Blocking Peptide, AI385605 Blocking Peptide, C78613 Blocking Peptide, D13Wsu50e Blocking Peptide, Med10, Med-10, Med 10, Med-10 Blocking Peptide, Med 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Med10 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors