MED14 Blocking Peptide (33R-1014)
A synthetic peptide for use as a blocking control in assays to test for specificity of MED14 antibody, catalog no. 70R-9589
Overview
Overview
| Synonyms | MED14 control peptide, MED14 antibody Blocking Peptide, Anti-MED14 Blocking Peptide, mediator complex subunit 14 Blocking Peptide, CRSP150 Blocking Peptide, CRSP2 Blocking Peptide, CSRP Blocking Peptide, CXorf4 Blocking Peptide, DRIP150 Blocking Peptide, EXLM1 Blocking Peptide, MGC104513 Blocking Peptide, RGR1 Blocking Peptide, TRAP170 Blocking Peptide, MED14, MED-14, MED 14, MED-14 Blocking Peptide, MED 14 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE |
|---|---|
| Molecular Weight | 160 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product