MED31 antibody (70R-4345)

Rabbit polyclonal MED31 antibody raised against the N terminal of MED31

Synonyms Polyclonal MED31 antibody, Anti-MED31 antibody, Soh1 antibody, MED-31, MED31, FLJ36714 antibody, Mediator Complex Subunit 31 antibody, 3110004H13Rik antibody, MED-31 antibody, MED 31, MED 31 antibody, FLJ27436 antibody, CGI-125 antibody
Specificity MED31 antibody was raised against the N terminal of MED31
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
Assay Information MED31 Blocking Peptide, catalog no. 33R-5587, is also available for use as a blocking control in assays to test for specificity of this MED31 antibody

Images

Western Blot analysis using MED31 antibody (70R-4345)

MED31 antibody (70R-4345) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MED31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MED31 antibody (70R-4345) | MED31 antibody (70R-4345) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors