MEMO1 antibody (70R-2308)

Rabbit polyclonal MEMO1 antibody raised against the middle region of MEMO1

Synonyms Polyclonal MEMO1 antibody, Anti-MEMO1 antibody, MEMO-1, CGI-27 antibody, DKFZp434I0135 antibody, Mediator Of Cell Motility 1 antibody, MEMO 1, MEMO-1 antibody, FLJ25031 antibody, MEMO1, C2orf4 antibody, MEMO 1 antibody, MEMO antibody, NS5ATP7 antibody
Specificity MEMO1 antibody was raised against the middle region of MEMO1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH
Assay Information MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody

Images

Western Blot analysis using MEMO1 antibody (70R-2308)

MEMO1 antibody (70R-2308) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MEMO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MEMO1 antibody (70R-2308) | MEMO1 antibody (70R-2308) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors