METAP1 antibody (70R-2201)

Rabbit polyclonal METAP1 antibody raised against the N terminal of METAP1

Synonyms Polyclonal METAP1 antibody, Anti-METAP1 antibody, DKFZp781C0419 antibody, METAP-1 antibody, METAP 1 antibody, METAP 1, Methionyl Aminopeptidase 1 antibody, KIAA0094 antibody, METAP1, METAP-1
Specificity METAP1 antibody was raised against the N terminal of METAP1
Cross Reactivity Human
Applications WB
Immunogen METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
Assay Information METAP1 Blocking Peptide, catalog no. 33R-3198, is also available for use as a blocking control in assays to test for specificity of this METAP1 antibody


Western Blot analysis using METAP1 antibody (70R-2201)

METAP1 antibody (70R-2201) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of METAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using METAP1 antibody (70R-2201) | METAP1 antibody (70R-2201) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors