Metaxin 2 antibody (70R-2450)

Rabbit polyclonal Metaxin 2 antibody raised against the N terminal of MTX2

Synonyms Polyclonal Metaxin 2 antibody, Anti-Metaxin 2 antibody, Metaxin 2 antibody, Metaxin 2, MGC111067 antibody, Metaxin -2 antibody, Metaxin 2, Metaxin -2, MTX2 antibody
Specificity Metaxin 2 antibody was raised against the N terminal of MTX2
Cross Reactivity Human
Applications WB
Immunogen Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
Assay Information Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody


Western Blot analysis using Metaxin 2 antibody (70R-2450)

Metaxin 2 antibody (70R-2450) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Metaxin 2 antibody (70R-2450) | Metaxin 2 antibody (70R-2450) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors