METTL5 antibody (70R-3352)

Rabbit polyclonal METTL5 antibody raised against the N terminal of METTL5

Synonyms Polyclonal METTL5 antibody, Anti-METTL5 antibody, FLJ10459 antibody, METTL5, METTL 5, METTL-5 antibody, METTL 5 antibody, HSPC133 antibody, Methyltransferase Like 5 antibody, METTL-5
Specificity METTL5 antibody was raised against the N terminal of METTL5
Cross Reactivity Human
Applications WB
Immunogen METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE
Assay Information METTL5 Blocking Peptide, catalog no. 33R-4497, is also available for use as a blocking control in assays to test for specificity of this METTL5 antibody


Western Blot analysis using METTL5 antibody (70R-3352)

METTL5 antibody (70R-3352) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of METTL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance METTL5 is a probable methyltransferase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using METTL5 antibody (70R-3352) | METTL5 antibody (70R-3352) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors