MGC20983 antibody (70R-4153)

Rabbit polyclonal MGC20983 antibody raised against the middle region of Mgc20983

Synonyms Polyclonal MGC20983 antibody, Anti-MGC20983 antibody, MGC20983, FLJ31801 antibody, MGC-20983, MGC 20983, MGC-20983 antibody, MGC 20983 antibody
Specificity MGC20983 antibody was raised against the middle region of Mgc20983
Cross Reactivity Human
Applications WB
Immunogen MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS
Assay Information MGC20983 Blocking Peptide, catalog no. 33R-3894, is also available for use as a blocking control in assays to test for specificity of this MGC20983 antibody


Western blot analysis using MGC20983 antibody (70R-4153)

Recommended MGC20983 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC20983 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the MGC20983 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using MGC20983 antibody (70R-4153) | Recommended MGC20983 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors