MGC33926 antibody (70R-1907)

Rabbit polyclonal MGC33926 antibody raised against the middle region of Mgc33926

Synonyms Polyclonal MGC33926 antibody, Anti-MGC33926 antibody, MGC33926, MGC-33926 antibody, MGC 33926, MGC 33926 antibody, , MGC-33926
Specificity MGC33926 antibody was raised against the middle region of Mgc33926
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF
Assay Information MGC33926 Blocking Peptide, catalog no. 33R-8049, is also available for use as a blocking control in assays to test for specificity of this MGC33926 antibody

Images

Western Blot analysis using MGC33926 antibody (70R-1907)

MGC33926 antibody (70R-1907) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MGC33926 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC33926 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC33926 antibody (70R-1907) | MGC33926 antibody (70R-1907) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors