MGC70924 antibody (70R-3194)

Rabbit polyclonal MGC70924 antibody raised against the N terminal Of Mgc70924

Synonyms Polyclonal MGC70924 antibody, Anti-MGC70924 antibody, MGC-70924 antibody, MGC 70924 antibody, MGC70924, MGC 70924, MGC-70924,
Specificity MGC70924 antibody was raised against the N terminal Of Mgc70924
Cross Reactivity Human
Applications WB
Immunogen MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR
Assay Information MGC70924 Blocking Peptide, catalog no. 33R-5880, is also available for use as a blocking control in assays to test for specificity of this MGC70924 antibody


Western Blot analysis using MGC70924 antibody (70R-3194)

MGC70924 antibody (70R-3194) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC70924 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC70924 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC70924 antibody (70R-3194) | MGC70924 antibody (70R-3194) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors