MICA antibody (70R-1705)

Rabbit polyclonal MICA antibody raised against the middle region of MICA

Synonyms Polyclonal MICA antibody, Anti-MICA antibody, Mhc Class I Polypeptide-Related Sequence A antibody, PERB11.1 antibody, MGC111087 antibody, DAQB-48K1.7 antibody
Specificity MICA antibody was raised against the middle region of MICA
Cross Reactivity Human
Applications WB
Immunogen MICA antibody was raised using the middle region of MICA corresponding to a region with amino acids LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT
Assay Information MICA Blocking Peptide, catalog no. 33R-5386, is also available for use as a blocking control in assays to test for specificity of this MICA antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MICA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors