MIER2 Blocking Peptide (33R-8048)
A synthetic peptide for use as a blocking control in assays to test for specificity of MIER2 antibody, catalog no. 70R-4353
Overview
Overview
| Synonyms | MIER2 control peptide, MIER2 antibody Blocking Peptide, Anti-MIER2 Blocking Peptide, Mesoderm Induction Early Response 1 Family Member 2 Blocking Peptide, KIAA1193 Blocking Peptide, MIER2, MIER-2, MIER 2, MIER-2 Blocking Peptide, MIER 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MIER2 is a transcriptional repressor. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product