MKL1 Blocking Peptide (33R-7678)
A synthetic peptide for use as a blocking control in assays to test for specificity of MKL1 antibody, catalog no. 20R-1166
Overview
Overview
| Synonyms | MKL1 control peptide, MKL1 antibody Blocking Peptide, Anti-MKL1 Blocking Peptide, MKL1, MKL-1, MKL 1, MKL-1 Blocking Peptide, MKL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK |
|---|---|
| Molecular Weight | 106 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product