MKL1 Blocking Peptide (33R-7678)

A synthetic peptide for use as a blocking control in assays to test for specificity of MKL1 antibody, catalog no. 20R-1166

Synonyms MKL1 control peptide, MKL1 antibody Blocking Peptide, Anti-MKL1 Blocking Peptide, MKL1, MKL-1, MKL 1, MKL-1 Blocking Peptide, MKL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Molecular Weight 106 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors