MKNK2 Blocking Peptide (33R-8351)
A synthetic peptide for use as a blocking control in assays to test for specificity of MKNK2 antibody, catalog no. 70R-5832
Overview
Overview
| Synonyms | MKNK2 control peptide, MKNK2 antibody Blocking Peptide, Anti-MKNK2 Blocking Peptide, Map Kinase Interacting Serine/Threonine Kinase 2 Blocking Peptide, GPRK7 Blocking Peptide, MNK2 Blocking Peptide, MKNK2, MKNK-2, MKNK 2, MKNK-2 Blocking Peptide, MKNK 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL |
|---|---|
| Molecular Weight | 51 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product