MKNK2 Blocking Peptide (33R-8351)

A synthetic peptide for use as a blocking control in assays to test for specificity of MKNK2 antibody, catalog no. 70R-5832

Synonyms MKNK2 control peptide, MKNK2 antibody Blocking Peptide, Anti-MKNK2 Blocking Peptide, Map Kinase Interacting Serine/Threonine Kinase 2 Blocking Peptide, GPRK7 Blocking Peptide, MNK2 Blocking Peptide, MKNK2, MKNK-2, MKNK 2, MKNK-2 Blocking Peptide, MKNK 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors