MKRN2 antibody (70R-2131)

Rabbit polyclonal MKRN2 antibody raised against the C terminal of MKRN2

Synonyms Polyclonal MKRN2 antibody, Anti-MKRN2 antibody, MKRN-2, MKRN 2 antibody, MKRN-2 antibody, MKRN2, HSPC070 antibody, Makorin Ring Finger Protein 2 antibody, MKRN 2, RNF62 antibody
Specificity MKRN2 antibody was raised against the C terminal of MKRN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS
Assay Information MKRN2 Blocking Peptide, catalog no. 33R-1071, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody


Western Blot analysis using MKRN2 antibody (70R-2131)

MKRN2 antibody (70R-2131) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MKRN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MKRN2 antibody (70R-2131) | MKRN2 antibody (70R-2131) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors