MLF1 antibody (70R-2146)

Rabbit polyclonal MLF1 antibody raised against the N terminal of MLF1

Synonyms Polyclonal MLF1 antibody, Anti-MLF1 antibody, MLF 1, MLF-1, MLF-1 antibody, MLF1, MLF 1 antibody, Myeloid Leukemia Factor 1 antibody
Specificity MLF1 antibody was raised against the N terminal of MLF1
Cross Reactivity Human
Applications WB
Immunogen MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
Assay Information MLF1 Blocking Peptide, catalog no. 33R-3521, is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody


Western Blot analysis using MLF1 antibody (70R-2146)

MLF1 antibody (70R-2146) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MLF1 antibody (70R-2146) | MLF1 antibody (70R-2146) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors