MMP1 antibody (70R-1555)

Rabbit polyclonal MMP1 antibody

Synonyms Polyclonal MMP1 antibody, Anti-MMP1 antibody, MMP 1, MMP 1 antibody, Matrix Metallopeptidase 1 antibody, Fibroblast collagenase, Interstitial Collagenase antibody, MMP-1 antibody, Matrix metalloproteinase-1, MMP-1, CLGN antibody, MMP1, CLG antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Assay Information MMP1 Blocking Peptide, catalog no. 33R-6984, is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody


Immunohistochemical staining using MMP1 antibody (70R-1555)

MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Recommended for IHC on human tissue. Working dilution 2-10 ug/mL


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MMP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MMP1 antibody (70R-1555) | MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Recommended for IHC on human tissue. Working dilution 2-10 ug/mL
  • Western Blot analysis using MMP1 antibody (70R-1555) | MMP1 antibody (70R-1555) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using MMP1 antibody (70R-1555) | MMP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows)  in Human Intestine. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors