MMP20 Blocking Peptide (33R-1063)

A synthetic peptide for use as a blocking control in assays to test for specificity of MMP20 antibody, catalog no. 70R-7198

Synonyms MMP20 control peptide, MMP20 antibody Blocking Peptide, Anti-MMP20 Blocking Peptide, Matrix Metallopeptidase 20 Blocking Peptide, MMP-20 Blocking Peptide, MMP20, MMP-20, MMP 20, MMP-20 Blocking Peptide, MMP 20 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors