MMP20 Blocking Peptide (33R-1063)
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP20 antibody, catalog no. 70R-7198
Overview
Overview
| Synonyms | MMP20 control peptide, MMP20 antibody Blocking Peptide, Anti-MMP20 Blocking Peptide, Matrix Metallopeptidase 20 Blocking Peptide, MMP-20 Blocking Peptide, MMP20, MMP-20, MMP 20, MMP-20 Blocking Peptide, MMP 20 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product