MORF4L1 antibody (70R-1284)

Rabbit polyclonal MORF4L1 antibody raised against the middle region of MORF4L1

Synonyms Polyclonal MORF4L1 antibody, Anti-MORF4L1 antibody, MORFL1 4 antibody, MORFL1-4 antibody, Mortality Factor 4 Like 1 antibody, MORF4L1, MORFL1-4, MORFL1 4
Specificity MORF4L1 antibody was raised against the middle region of MORF4L1
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen MORF4L1 antibody was raised using the middle region of MORF4L1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
Assay Information MORF4L1 Blocking Peptide, catalog no. 33R-10055, is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Images

Immunohistochemical staining using MORF4L1 antibody (70R-1284)

MORF4L1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Smooth muscle cells (arrows) in Human urinary bladder. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MORF4L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5-10 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MORF4L1 antibody (70R-1284) | MORF4L1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Smooth muscle cells (arrows) in Human urinary bladder. Magnification is at 400X.
  • Western Blot analysis using MORF4L1 antibody (70R-1284) | MORF4L1 antibody (70R-1284) used at 5-10 ug/ml to detect target protein.
  • Immunohistochemical staining using MORF4L1 antibody (70R-1284) | MORF4L1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors