MOSPD3 antibody (70R-1823)

Rabbit polyclonal MOSPD3 antibody raised against the C terminal of MOSPD3

Synonyms Polyclonal MOSPD3 antibody, Anti-MOSPD3 antibody, MOSPD-3, MOSPD3, MOSPD 3, MOSPD-3 antibody, Motile Sperm Domain Containing 3 antibody, MOSPD 3 antibody, CDS3 antibody
Specificity MOSPD3 antibody was raised against the C terminal of MOSPD3
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM
Assay Information MOSPD3 Blocking Peptide, catalog no. 33R-2967, is also available for use as a blocking control in assays to test for specificity of this MOSPD3 antibody

Images

Western Blot analysis using MOSPD3 antibody (70R-1823)

MOSPD3 antibody (70R-1823) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MOSPD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MOSPD3 antibody (70R-1823) | MOSPD3 antibody (70R-1823) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors