MPP2 antibody (70R-2664)

Rabbit polyclonal MPP2 antibody

Synonyms Polyclonal MPP2 antibody, Anti-MPP2 antibody, DLG2 antibody, MPP-2 antibody, DKFZp686J2189 antibody, Maguk P55 Subfamily Member 2 antibody, MPP 2, DKFZp686A06252 antibody, Membrane Protein Palmitoylated 2 antibody, MPP-2, MPP2, MPP 2 antibody, DKFZp761D0712 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME
Assay Information MPP2 Blocking Peptide, catalog no. 33R-7575, is also available for use as a blocking control in assays to test for specificity of this MPP2 antibody

Images

Western Blot analysis using MPP2 antibody (70R-2664)

MPP2 antibody (70R-2664) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPP2 antibody (70R-2664) | MPP2 antibody (70R-2664) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors