MPP3 antibody (70R-2662)

Rabbit polyclonal MPP3 antibody

Synonyms Polyclonal MPP3 antibody, Anti-MPP3 antibody, MPP 3 antibody, Maguk P55 Subfamily Member 3 antibody, Membrane Protein Palmitoylated 3 antibody, MPP3, MPP 3, MPP-3, DLG3 antibody, MPP-3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV
Assay Information MPP3 Blocking Peptide, catalog no. 33R-7863, is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody


Western Blot analysis using MPP3 antibody (70R-2662)

MPP3 antibody (70R-2662) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MPP3 antibody (70R-2662) | MPP3 antibody (70R-2662) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors