MPPED2 Blocking Peptide (33R-7906)
A synthetic peptide for use as a blocking control in assays to test for specificity of MPPED2 antibody, catalog no. 70R-5251
Overview
Overview
| Synonyms | MPPED2 control peptide, MPPED2 antibody Blocking Peptide, Anti-MPPED2 Blocking Peptide, Metallophosphoesterase Domain Containing 2 Blocking Peptide, 239FB Blocking Peptide, C11orf8 Blocking Peptide, D11S302E Blocking Peptide, FAM1B Blocking Peptide, Hs.46638 Blocking Peptide, dJ1024C24.1 Blocking Peptide, dJ873F21.1 Blocking Peptide, MPPED2, MPPED-2, MPPED 2, MPPED-2 Blocking Peptide, MPPED 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of MPPED2 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product