MPPED2 Blocking Peptide (33R-7906)

A synthetic peptide for use as a blocking control in assays to test for specificity of MPPED2 antibody, catalog no. 70R-5251

Synonyms MPPED2 control peptide, MPPED2 antibody Blocking Peptide, Anti-MPPED2 Blocking Peptide, Metallophosphoesterase Domain Containing 2 Blocking Peptide, 239FB Blocking Peptide, C11orf8 Blocking Peptide, D11S302E Blocking Peptide, FAM1B Blocking Peptide, Hs.46638 Blocking Peptide, dJ1024C24.1 Blocking Peptide, dJ873F21.1 Blocking Peptide, MPPED2, MPPED-2, MPPED 2, MPPED-2 Blocking Peptide, MPPED 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of MPPED2 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors