MPST antibody (70R-2488)

Rabbit polyclonal MPST antibody raised against the middle region of MPST

Synonyms Polyclonal MPST antibody, Anti-MPST antibody, Mercaptopyruvate Sulfurtransferase antibody, TST2 antibody, MST antibody, MGC24539 antibody
Specificity MPST antibody was raised against the middle region of MPST
Cross Reactivity Human
Applications WB
Immunogen MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
Assay Information MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody

Images

Western Blot analysis using MPST antibody (70R-2488)

MPST antibody (70R-2488) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPST antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPST antibody (70R-2488) | MPST antibody (70R-2488) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors