MRPL15 antibody (70R-2422)

Rabbit polyclonal MRPL15 antibody raised against the N terminal of MRPL15

Synonyms Polyclonal MRPL15 antibody, Anti-MRPL15 antibody, RPML7 antibody, MRPL-15 antibody, MRPL 15 antibody, HSPC145 antibody, Mitochondrial Ribosomal Protein L15 antibody, MRP-L7 antibody, MRPL-15, MRPL 15, MRPL15
Specificity MRPL15 antibody was raised against the N terminal of MRPL15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN
Assay Information MRPL15 Blocking Peptide, catalog no. 33R-4583, is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody


Western Blot analysis using MRPL15 antibody (70R-2422)

MRPL15 antibody (70R-2422) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MRPL15 antibody (70R-2422) | MRPL15 antibody (70R-2422) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors