MRPL28 antibody (70R-2418)

Rabbit polyclonal MRPL28 antibody raised against the middle region of MRPL28

Synonyms Polyclonal MRPL28 antibody, Anti-MRPL28 antibody, MRPL 28, MRPL28, MGC8499 antibody, p15 antibody, Mitochondrial Ribosomal Protein L28 antibody, MRPL 28 antibody, MAAT1 antibody, MRPL-28, MRPL-28 antibody
Specificity MRPL28 antibody was raised against the middle region of MRPL28
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK
Assay Information MRPL28 Blocking Peptide, catalog no. 33R-2324, is also available for use as a blocking control in assays to test for specificity of this MRPL28 antibody


Western Blot analysis using MRPL28 antibody (70R-2418)

MRPL28 antibody (70R-2418) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MRPL28 antibody (70R-2418) | MRPL28 antibody (70R-2418) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors