MRPL39 antibody (70R-2412)

Rabbit polyclonal MRPL39 antibody raised against the N terminal of MRPL39

Synonyms Polyclonal MRPL39 antibody, Anti-MRPL39 antibody, MGC3400 antibody, MRPL 39 antibody, MGC104174 antibody, MRPL 39, MRP-L5 antibody, PRED22 antibody, MSTP003 antibody, MRPL39, FLJ20451 antibody, Mitochondrial Ribosomal Protein L39 antibody, RPML5 antibody, L39mt antibody, MRPL-39, PRED66 antibody, C21orf92 antibody, MRPL-39 antibody
Specificity MRPL39 antibody was raised against the N terminal of MRPL39
Cross Reactivity Human
Applications WB
Immunogen MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST
Assay Information MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

Images

Western Blot analysis using MRPL39 antibody (70R-2412)

MRPL39 antibody (70R-2412) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPL39 antibody (70R-2412) | MRPL39 antibody (70R-2412) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors