MRPL45 Blocking Peptide (33R-7901)

A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL45 antibody, catalog no. 70R-10085

Synonyms MRPL45 control peptide, MRPL45 antibody Blocking Peptide, Anti-MRPL45 Blocking Peptide, mitochondrial ribosomal protein L45 Blocking Peptide, MGC11321 Blocking Peptide, MRPL45, MRPL-45, MRPL 45, MRPL-45 Blocking Peptide, MRPL 45 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPI
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 2p and 17q.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors