MRPL48 antibody (70R-2434)

Rabbit polyclonal MRPL48 antibody raised against the middle region of MRPL48

Synonyms Polyclonal MRPL48 antibody, Anti-MRPL48 antibody, MGC13323 antibody, MRPL-48, MRPL 48, MRPL48, CGI-118 antibody, MRPL-48 antibody, Mitochondrial Ribosomal Protein L48 antibody, MRPL 48 antibody
Specificity MRPL48 antibody was raised against the middle region of MRPL48
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK
Assay Information MRPL48 Blocking Peptide, catalog no. 33R-4469, is also available for use as a blocking control in assays to test for specificity of this MRPL48 antibody

Images

Western Blot analysis using MRPL48 antibody (70R-2434)

MRPL48 antibody (70R-2434) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL48 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPL48 antibody (70R-2434) | MRPL48 antibody (70R-2434) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors