MRPS2 antibody (70R-2423)

Rabbit polyclonal MRPS2 antibody raised against the N terminal of MRPS2

Synonyms Polyclonal MRPS2 antibody, Anti-MRPS2 antibody, MRPS-2 antibody, MRPS2, Mitochondrial Ribosomal Protein S2 antibody, MRP-S2 antibody, MRPS 2, MRPS 2 antibody, MRPS-2, CGI-91 antibody
Specificity MRPS2 antibody was raised against the N terminal of MRPS2
Cross Reactivity Human
Applications WB
Immunogen MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
Assay Information MRPS2 Blocking Peptide, catalog no. 33R-5791, is also available for use as a blocking control in assays to test for specificity of this MRPS2 antibody

Images

Western Blot analysis using MRPS2 antibody (70R-2423)

MRPS2 antibody (70R-2423) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPS2 antibody (70R-2423) | MRPS2 antibody (70R-2423) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors