MSH4 antibody (70R-5617)

Rabbit polyclonal MSH4 antibody

Synonyms Polyclonal MSH4 antibody, Anti-MSH4 antibody, MSH4, MSH 4, MSH 4 antibody, Muts Homolog 4 antibody, MSH-4, MSH-4 antibody
Cross Reactivity Human
Applications WB
Immunogen MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY
Assay Information MSH4 Blocking Peptide, catalog no. 33R-2488, is also available for use as a blocking control in assays to test for specificity of this MSH4 antibody


Western Blot analysis using MSH4 antibody (70R-5617)

MSH4 antibody (70R-5617) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSH4 is involved in meiotic recombination. MSH4 is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSH4 antibody (70R-5617) | MSH4 antibody (70R-5617) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors