MSI2 antibody (70R-1394)

Rabbit polyclonal MSI2 antibody

Synonyms Polyclonal MSI2 antibody, Anti-MSI2 antibody, MSI2, Musashi Homolog 2 antibody, MSI-2, MSI 2 antibody, MSI-2 antibody, MSI 2
Cross Reactivity Human, Mouse, Rat, C.elegans, ZebraFish
Applications IHC, WB
Immunogen MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL
Assay Information MSI2 Blocking Peptide, catalog no. 33R-5352, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody


Immunohistochemical staining using MSI2 antibody (70R-1394)

MSI2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MSI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MSI2 antibody (70R-1394) | MSI2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using MSI2 antibody (70R-1394) | MSI2 antibody (70R-1394) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using MSI2 antibody (70R-1394) | MSI2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors