MSI2 antibody (70R-4769)

Rabbit polyclonal MSI2 antibody

Synonyms Polyclonal MSI2 antibody, Anti-MSI2 antibody, MSI-2 antibody, Musashi Homolog 2 antibody, MSI 2, MSI 2 antibody, MSI-2, MGC3245 antibody, MSI2, FLJ36569 antibody, MSI2H antibody
Cross Reactivity Human
Applications WB
Immunogen MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI
Assay Information MSI2 Blocking Peptide, catalog no. 33R-10266, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody


Western Blot analysis using MSI2 antibody (70R-4769)

MSI2 antibody (70R-4769) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSI2 antibody (70R-4769) | MSI2 antibody (70R-4769) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors