MTCH2 antibody (70R-2533)

Rabbit polyclonal MTCH2 antibody

Synonyms Polyclonal MTCH2 antibody, Anti-MTCH2 antibody, MTCH 2, Mitochondrial Carrier Homolog 2 antibody, MTCH-2 antibody, MTCH2, HSPC032 antibody, MTCH 2 antibody, MTCH-2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
Assay Information MTCH2 Blocking Peptide, catalog no. 33R-1082, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody


Western Blot analysis using MTCH2 antibody (70R-2533)

MTCH2 antibody (70R-2533) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTCH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTCH2 antibody (70R-2533) | MTCH2 antibody (70R-2533) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors