MTCH2 Blocking Peptide (33R-1082)
A synthetic peptide for use as a blocking control in assays to test for specificity of MTCH2 antibody, catalog no. 70R-2533
Overview
Overview
| Synonyms | MTCH2 control peptide, MTCH2 antibody Blocking Peptide, Anti-MTCH2 Blocking Peptide, Mitochondrial Carrier Homolog 2 Blocking Peptide, HSPC032 Blocking Peptide, MTCH2, MTCH-2, MTCH 2, MTCH-2 Blocking Peptide, MTCH 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product