MTCH2 Blocking Peptide (33R-1082)

A synthetic peptide for use as a blocking control in assays to test for specificity of MTCH2 antibody, catalog no. 70R-2533

Synonyms MTCH2 control peptide, MTCH2 antibody Blocking Peptide, Anti-MTCH2 Blocking Peptide, Mitochondrial Carrier Homolog 2 Blocking Peptide, HSPC032 Blocking Peptide, MTCH2, MTCH-2, MTCH 2, MTCH-2 Blocking Peptide, MTCH 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors