MTHFS Blocking Peptide (33R-9306)
A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-3776
Overview
Overview
| Synonyms | MTHFS control peptide, MTHFS antibody Blocking Peptide, Anti-MTHFS Blocking Peptide, 5-10-Methenyltetrahydrofolate Synthetase Blocking Peptide, 5-Formyltetrahydrofolate Cyclo-Ligase Blocking Peptide, FLJ30410 Blocking Peptide, HsT19268 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product