MTHFS Blocking Peptide (33R-9307)

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-4127

Synonyms MTHFS control peptide, MTHFS antibody Blocking Peptide, Anti-MTHFS Blocking Peptide, 5-10-Methenyltetrahydrofolate Synthetase Blocking Peptide, 5-Formyltetrahydrofolate Cyclo-Ligase Blocking Peptide, FLJ30410 Blocking Peptide, HsT19268 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors