MTMR1 antibody (70R-1275)

Rabbit polyclonal MTMR1 antibody raised against the C terminal of MTMR1

Synonyms Polyclonal MTMR1 antibody, Anti-MTMR1 antibody, MTMR-1 antibody, MTMR-1, MTMR1, MTMR 1, Myotubularin Related Protein 1 antibody, MTMR 1 antibody
Specificity MTMR1 antibody was raised against the C terminal of MTMR1
Cross Reactivity Human,Mouse
Applications WB
Immunogen MTMR1 antibody was raised using the C terminal of MTMR1 corresponding to a region with amino acids KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
Assay Information MTMR1 Blocking Peptide, catalog no. 33R-4322, is also available for use as a blocking control in assays to test for specificity of this MTMR1 antibody


Western Blot analysis using MTMR1 antibody (70R-1275)

MTMR1 antibody (70R-1275) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MTMR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTMR1 antibody (70R-1275) | MTMR1 antibody (70R-1275) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors