MTO1 antibody (70R-2514)

Rabbit polyclonal MTO1 antibody

Synonyms Polyclonal MTO1 antibody, Anti-MTO1 antibody, MTO1, MTO-1 antibody, MTO 1 antibody, CGI-02 antibody, Mitochondrial Translation Optimization 1 Homolog antibody, MTO-1, MTO 1
Cross Reactivity Human
Applications WB
Immunogen MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV
Assay Information MTO1 Blocking Peptide, catalog no. 33R-8897, is also available for use as a blocking control in assays to test for specificity of this MTO1 antibody


Western Blot analysis using MTO1 antibody (70R-2514)

MTO1 antibody (70R-2514) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTO1 antibody (70R-2514) | MTO1 antibody (70R-2514) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors