MTRR Blocking Peptide (33R-10071)

A synthetic peptide for use as a blocking control in assays to test for specificity of MTRR antibody, catalog no. 70R-4020

Synonyms MTRR control peptide, MTRR antibody Blocking Peptide, Anti-MTRR Blocking Peptide, 5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase Blocking Peptide, MGC129643 Blocking Peptide, MSR Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
Molecular Weight 80 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors