MTRR Blocking Peptide (33R-10071)
A synthetic peptide for use as a blocking control in assays to test for specificity of MTRR antibody, catalog no. 70R-4020
Overview
Overview
| Synonyms | MTRR control peptide, MTRR antibody Blocking Peptide, Anti-MTRR Blocking Peptide, 5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase Blocking Peptide, MGC129643 Blocking Peptide, MSR Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
|---|---|
| Molecular Weight | 80 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product